SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187477524|ref|YP_785548.1| from Bordetella avium 197N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187477524|ref|YP_785548.1|
Domain Number 1 Region: 150-333
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-59
Family Methylesterase CheB, C-terminal domain 0.000023
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily CheY-like 1.12e-19
Family CheY-related 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187477524|ref|YP_785548.1|
Sequence length 342
Comment chemotaxis-specific methylesterase [Bordetella avium 197N]
Sequence
MRVAIVNDMPLAVEALRRSLAHDPELSLAWIASDGLQAVRRCAADLPDVILMDLMMPVMN
GVEATRLIMAESPCAIIVVTSDVLQHTSLVFEAMGHGALDAVDTPVLGRGDPKAAAQRLL
RKIRNAGWLIGKKTVALERTTAMASSDTDAALVVIGASAGGPPSLAAVLRALPASFPAAI
VLVQHVDAAFTSGMAAWLNEQCVLPVRLASDGLRPEAGVVLLAGAGEHLVLGAERKLHYT
TEPRESVYSPSIDVFFHSVAQHWRGRAAGVLLTGMGQDGALGLKAMRERGFFTIAQDRAT
SAVYGMPKAAAALDAACEILPLGDIAPRLEKVFAPPANPLFN
Download sequence
Identical sequences Q2KV65
360910.BAV1025 WP_012416711.1.34902 WP_012416711.1.73991 gi|187477524|ref|YP_785548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]