SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|187478965|ref|YP_786989.1| from Bordetella avium 197N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187478965|ref|YP_786989.1|
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.72e-23
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187478965|ref|YP_786989.1|
Sequence length 164
Comment acetyltransferase [Bordetella avium 197N]
Sequence
MTFDISFRQARPEDADRCYEIEIAAYEGDEAATREKIALRIDQYPQGFLIMERAGRIMGF
INSGCAHDVVMSDEAFKQLLGHDPEAVNVVIMSVVLDPAEQGRGYSTRLMATFVQRMRDQ
GKATIHLMCKAHHIELYRRFGYQYVKPSESDHGGMAWHEMLMVL
Download sequence
Identical sequences Q2KXJ1
WP_012418136.1.73991 gi|187478965|ref|YP_786989.1| 360910.BAV2477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]