SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187479724|ref|YP_787749.1| from Bordetella avium 197N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187479724|ref|YP_787749.1|
Domain Number 1 Region: 8-245,403-460
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.65e-47
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 256-400
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.74e-32
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187479724|ref|YP_787749.1|
Sequence length 465
Comment reductase flavoprotein subunit [Bordetella avium 197N]
Sequence
MSASIPSLSTQLLVIGGGLAGFAAALEAAQAGTEVILLEKMPETGGSSAMSGGCLAFAGT
DLQAAEGIEDSAELLKRDLIEVGQHENDPELVQTYVDHQLQTYEWLKQQGVAFSPVIEAS
SGQSVPRVHTVDPADTVRLLQARCLETGRVQVFTRTRALRLVRSSETAPVQAILACGPDG
EFTIRASLGVLLASGGFGKNAELVHRFVPHYDNAVFVCGEGNVGDGLAMARKLGADVRDM
IYIKGTYGKHPVDTTNHHSCLAVYKGAIAVNEEGKRFVDESISYKLLGDAVMAQPYHTSF
QIFDQPIFESGDDRVRILDFQRRMEEGLIIQADTLQGLAQQIEVPYETLKATVDNYNRYC
DEKHDPEFGRKKLVHNHGELRRIETGPFYAYPSTASVFGTYCGLRVNAAMQVVDVFGDRI
PGLYAAGEIMGGFHGGAYMTGSALGKACVFGRVAAQTALRSGQQI
Download sequence
Identical sequences Q2KTZ6
360910.BAV3254 WP_012418891.1.34902 WP_012418891.1.73991 gi|187479724|ref|YP_787749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]