SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218779747|ref|YP_002431065.1| from Desulfatibacillum alkenivorans AK-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218779747|ref|YP_002431065.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.96e-33
Family Ribosomal protein L6 0.0000639
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 5.52e-23
Family Ribosomal protein L6 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218779747|ref|YP_002431065.1|
Sequence length 178
Comment 50S ribosomal protein L6 [Desulfatibacillum alkenivorans AK-01]
Sequence
MSRVGKKPIPIPAKTKVTVSNGTVTVQGEKGKLERPLHPDVELKIEGDEITVVPVVERRK
ITAVQGLVRSLVANMVTGVSTGFKRVLEVNGIGYKAELNGQTLNLTLGFSHPVDFPLPQG
ITAEVDKKNNITLEGIDNELLGQTAASIRALRPPEPYKGKGIKYAEERIIRKAGKTGA
Download sequence
Identical sequences B8FES0
gi|218779747|ref|YP_002431065.1| 439235.Dalk_1900 WP_012611028.1.12191 WP_012611028.1.94734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]