SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218780986|ref|YP_002432304.1| from Desulfatibacillum alkenivorans AK-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218780986|ref|YP_002432304.1|
Domain Number 1 Region: 168-437
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.44e-53
Family Tricorn protease N-terminal domain 0.0061
Further Details:      
 
Domain Number 2 Region: 38-173
Classification Level Classification E-value
Superfamily TolB, N-terminal domain 1.31e-17
Family TolB, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218780986|ref|YP_002432304.1|
Sequence length 442
Comment hypothetical protein Dalk_3146 [Desulfatibacillum alkenivorans AK-01]
Sequence
MSKTFNRTACTCFLFLLIMTVLAGSASAARYEYWINNPFLRKIPIAIKDFEPKTVNEEPR
QAAVQAKEWLVSGLEFVRYFQILPEESYIIGDGEGLTAQTINFANWVSIGADHLVTGGLD
LRDGVLVLELRLFDVPRNRLIVGKRYKGRVEDMRKMIRRFCVEIVTELTDSRGVFGTKIA
FVSNGPGNKEIFACEYDGFDPQQLTSGSKIALSPAWSGDGTHMAYVSYADGPPEIFIRNL
AQKRGVKVAYKGINVTPAWDPTRFALAATLSLNGDQEIYSLTGNGKIIKKLTNNWGIDVS
PSYSPDGKRMAFVSNRGGSPQIYIMELDTGQTSRVTFDGKYNSAPAFSPRGDRIAYCGMV
DGTFDVFTVRTDGTDLQRLTDHPGDDEEPSWSPDGTLIAFSTTREGKAKIYVMTSHGTDQ
RKLLELEGAQTQPAWSPWLGDY
Download sequence
Identical sequences B8FBT3
gi|218780986|ref|YP_002432304.1| WP_015947896.1.12191 439235.Dalk_3146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]