SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218781347|ref|YP_002432665.1| from Desulfatibacillum alkenivorans AK-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218781347|ref|YP_002432665.1|
Domain Number 1 Region: 454-591
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.88e-22
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.048
Further Details:      
 
Weak hits

Sequence:  gi|218781347|ref|YP_002432665.1|
Domain Number - Region: 255-305
Classification Level Classification E-value
Superfamily E set domains 0.00476
Family RhoGDI-like 0.046
Further Details:      
 
Domain Number - Region: 44-199
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0122
Family Tricorn protease N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218781347|ref|YP_002432665.1|
Sequence length 685
Comment hypothetical protein Dalk_3509 [Desulfatibacillum alkenivorans AK-01]
Sequence
MDIPGEGSIVNHEFQWYAPSYTSIPGGGTTETQYTRLLQTSATLSKDPAGNVFASNEYTL
DKSGNVTNRISHNDSIGYAYDDLGRLISHVSQSSGTETFTYDEVANIATALENGQPITFT
RNANNELLSYGDATFQYDENGAVISRTENNETVNYFYDVDGRMIRVENGSGGVIAEYCYD
PFGRRLWKEVNGTRTCYFYSDEGLIGEFTSTGTLIKSYGYKPDSMWSSNPLFMVQDGVYY
YYHNDRIGAPQVLVRANGSTAWSATYSAYGKASVDPDSDVENNLRFPGQYYDAETGLHYN
LNRYYDPEIGAYRSPDPLGLGGGVNLYAYTAGNPANYVDPLGLLFSSMDNPTGYLVMETI
LLGDKILSVVETVKTIKEAIDVVKDPCLTDEEKYDYFKGVAGDLIIDALIGKALGKLGDI
MGGAGKKGADYVDDVHIHGIDNFDTKKTAIPGPCFTAGTLVSTDQGLTPIEEIEPGDMVL
SRDEESGLTEYKQVVQTFITPEQSVLELELEDGDGNVEEIGVTPDHPFRVKGKGWVGAQK
LLPGDEVYTSRGGWLRVSGGAWLEGTRTVYNMEVKDFHTYFVGQSAAWVHNMCADDIIKK
VYNSIKDAPNYPVGFRAIQNGLSKNIINNKELLENLRKIESGKWYKVYKDGYDAMGNKVT
IHYFQSKSGKVFNVKVYYNKWSNER
Download sequence
Identical sequences B8FBZ2
gi|218781347|ref|YP_002432665.1| 439235.Dalk_3509 WP_015948254.1.12191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]