SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218781812|ref|YP_002433130.1| from Desulfatibacillum alkenivorans AK-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218781812|ref|YP_002433130.1|
Domain Number 1 Region: 113-263
Classification Level Classification E-value
Superfamily Receptor-binding domain of short tail fibre protein gp12 9.16e-37
Family Receptor-binding domain of short tail fibre protein gp12 0.00073
Further Details:      
 
Weak hits

Sequence:  gi|218781812|ref|YP_002433130.1|
Domain Number - Region: 50-131
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0112
Family Tricorn protease N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218781812|ref|YP_002433130.1|
Sequence length 264
Comment hypothetical protein Dalk_3976 [Desulfatibacillum alkenivorans AK-01]
Sequence
MTTWDASFETIPADSDNISAGAGVIRTLKSAVRERMAKDHYMALDGEDGDHGEHGKVTFH
QPLASNPSTGEDKGVLYTMDVDDTAELHWKDEGGNVLTLTAQGAINYTPDESLINPTGSV
VAFMGASAPSGWLECSGAAVSRTTYDNLFSVISTMYGVGDGSTTFNLPDLRGYFLRGWSH
GSGKDPDAGSRTDRGDGTCGDYVGTRQEDEFASHTHYDDEDLLTFDGGGPVGSNSSGMSA
VLPGSVGGAETRPKNVAVMYIIKT
Download sequence
Identical sequences B8FJJ3
gi|218781812|ref|YP_002433130.1| 439235.Dalk_3976 WP_015948711.1.12191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]