SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218778004|ref|YP_002429322.1| from Desulfatibacillum alkenivorans AK-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218778004|ref|YP_002429322.1|
Domain Number 1 Region: 233-274,307-335,427-628
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.01e-45
Family CoA transferase alpha subunit-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218778004|ref|YP_002429322.1|
Sequence length 728
Comment hypothetical protein Dalk_0144 [Desulfatibacillum alkenivorans AK-01]
Sequence
MADNQPTFYDDVEKCADDIIRIMGKRVNFAMPLALGKSYHLTNELYRRAKEDPEIQLTFV
TALALEKPTWSSDLEKRLVKPMRERIWKGVPDFDYVLDMRKNALPKNVVVTEFFFKAGSY
NNVPMAQQNHSSSNYTHAIRDITNCFDTLVACQCVCKGEIDGETVYSNSCNSDLAYEIYP
SKLEAERMGKKVIYIGHVNDTLPFMYGDAVEPEHHFDMILDSPKYCFPLFSAPKAPVCTK
DYMIGLHVSSLIKDGGTLQIGIGTLGDAIASGLLMRHHNNGDYNQLLDDLGINNRYSRLI
DKIGGRDEFAQGLYGATEMLVDVFIELYTGGIIKRNVYHNIPLMRMINDGALQEEFTPES
VKELLLQDEHFPILKEQDFISLRNYGIFKDDLRYEDYHLVNGAGKYSVDFRDSANLDAVL
ENCLGDRLKNGVVLTGSFFIGPNGFYDFLRDMSDEERKKFEMTGVKVVNQLYGDEVLRSL
ERKDARFVNAGMKISLMGNVASDALRNGTVISGVGGQYNFVSMAHALPDARLIMMLRSTK
ETPKEVKSNILFNYGYTTIPRHLRDIVVTEYGIADLRSKQDWVVMTELIKVADSRFQDEL
LDEAKKAGKVPMDYEIPYEYRNNYPDQLEKKLAPFKAKGYFKPFPFGKEFTDEEVALGAS
LRKFKGGMTANKFKASKALIKDFKAPVPPEATPYLKRMNLDAPKGVKEKLMQKLVVHALS
NAGYVKLQ
Download sequence
Identical sequences B8FMI7
439235.Dalk_0144 gi|218778004|ref|YP_002429322.1| WP_012609294.1.12191 WP_012609294.1.94734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]