SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218782212|ref|YP_002433530.1| from Desulfatibacillum alkenivorans AK-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218782212|ref|YP_002433530.1|
Domain Number 1 Region: 130-405
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.05e-24
Family Tricorn protease N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 46-179
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000981
Family DPP6 N-terminal domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218782212|ref|YP_002433530.1|
Sequence length 610
Comment Periplasmic component of the Tol biopolymer transport system-like protein [Desulfatibacillum alkenivorans AK-01]
Sequence
MKRGFKCALVRALILLLILGPISGWAADSSEDWGLDGAVTDTEGLVVNILELSTEYDSAY
PGWGNWNWSSDGAKIVYQVDDSNLSNSSEICVINADGTGFTRLTDNDRCDSHASFVWPNN
AKVVFQRNVASSGNGEIWIVNVDGSNPTSLTQAHNGPMGGASAGENNPMVSPDGTKVAFR
GCVPASDGYAHLFVMDIDGANVKDVAAYNDRIIDISHHCWSPDSKWVCFKACDESVGDAR
IFKVKADGTAAPVKLSPADDAMPAAWNDWFCQNWPRWSPDGKWISTSLYTGENYNDKKIV
IMDSDGQNMKTIMAQDGDDDGDNYDWIHQSGTWSPDSKWLVYSMNTVAEGDTALCISNVD
NGAFYQLTKDYEDCQPRWSPSPKNKPGSILFKGHSGGDGLFLLNLAPWALDEISASGRSD
FASCGSTSWSQAGICLDVDLGAGGEEPIFIGALYDGNPTPQNFDGTFWDLYCPDPTNVVS
VTLGLYFNGYYPGMGFYWFDEDANNWDELDPLMCEVTEGLYLRSGITYTAVISMTLTSVT
TPSLEQLTGTVFAAGSIPEDDDIFDWAGKDDLDCFVKSVDGGKTSAAPYALLFLGLAMGF
AFFNRPASRK
Download sequence
Identical sequences B8FN93
gi|218782212|ref|YP_002433530.1| WP_015949108.1.12191 439235.Dalk_4383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]