SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|192361442|ref|YP_001981782.1| from Cellvibrio japonicus Ueda107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|192361442|ref|YP_001981782.1|
Domain Number 1 Region: 199-333
Classification Level Classification E-value
Superfamily CBS-domain pair 1.22e-25
Family CBS-domain pair 0.004
Further Details:      
 
Domain Number 2 Region: 339-422
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.45e-21
Family CorC/HlyC domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|192361442|ref|YP_001981782.1|
Sequence length 424
Comment hypothetical protein CJA_1291 [Cellvibrio japonicus Ueda107]
Sequence
MEIFILLGLILLNGLFAMSEIAIVTAKKSRLMAMAAKGRHSAQAALTLAEDPTQFLSTVQ
IGITSIGIMSGIFGESILAEPFAIWLQGLGMPAHFSDNFATALVVVVVTYLSIVIGELVP
KRIGQIIAEPIACFMAKPMQFLALATKPFVSLLSGSTRTLMRLLGFNQYQNQQVTEEDIH
AILQEGSNTGIIEAQEHTMVKNVLRLEDRSIASLMVPRADIVYLDTELSLEDNYQRVIGS
PHSRFPVCQKNTDNLLGVINAKELLSAAIRGQAIDLAAIAKPCHVVPESLTGMELLEFFR
SSQTQMVFVVDEYGVIQGLATLQDLLESLTGEFITGDGEDAYVIRRDDGSLLLDGMLSIV
DLKDCLGLDELPEEGSYQTLNGLMMLLIGRMPVTGDKVELQRWQLEIVDMDGRRIDKVLA
YLLD
Download sequence
Identical sequences B3PCH4
498211.CJA_1291 WP_012486928.1.61722 gi|192361442|ref|YP_001981782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]