SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193214226|ref|YP_001995425.1| from Chloroherpeton thalassium ATCC 35110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193214226|ref|YP_001995425.1|
Domain Number 1 Region: 1-273
Classification Level Classification E-value
Superfamily Folate-binding domain 5.34e-104
Family Aminomethyltransferase folate-binding domain 0.000000143
Further Details:      
 
Domain Number 2 Region: 277-360
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 2.13e-22
Family Aminomethyltransferase beta-barrel domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193214226|ref|YP_001995425.1|
Sequence length 362
Comment glycine cleavage system T protein [Chloroherpeton thalassium ATCC 35110]
Sequence
MKYTPLHKIHQQLGAKLVDFAGFEMPVQYDGILVEHKAVREAVGLFDVSHMGEFEVKGKG
AKAFLQNMTTNDVESLCDGKAQYSLLLYEDGGVVDDLLVYKIADEHYFLIVNASNIEKDF
DWLKQHQPDDEVVLENRSDELSLIAIQGPKAEAVLSKLTDVPLDAIKYYHFVFGDVCGKR
TLISRTGYTGEAGFELCMANEHAEEIWHALIEAGLPFGIVPVGLGARDTLRLEMGYSLYG
HEIDHQTNPYEAQLGWITKLQKGDFIGKNACVEKKLHLEQTLVGFTLTGKNIPRQGYKIQ
DLSGTDIGVVCSGTLSPTLGKPIGTGYVKSSFSKIDSKVYINIRGKLQEAAVVKVPFLHK
NR
Download sequence
Identical sequences B3QV24
WP_012499062.1.43748 517418.Ctha_0507 gi|193214226|ref|YP_001995425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]