SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193215309|ref|YP_001996508.1| from Chloroherpeton thalassium ATCC 35110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193215309|ref|YP_001996508.1|
Domain Number 1 Region: 87-406
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.89e-86
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193215309|ref|YP_001996508.1|
Sequence length 409
Comment proline dehydrogenase [Chloroherpeton thalassium ATCC 35110]
Sequence
MTASKSYNAPYSYSPVADEILDSFENTQIAYEQKSDLELNWSYFLFRMMNNDLLTKLGTT
LTDMAFQFELPVDGFIKFTLFQQFCGGETLSECRTAVRKLGHFNVKSILDYSSEGDGDEE
SFDWAVEKILETLEVAQEDCNVPFIVFKPSGLAPTDILEAVSDGETLSGKEQAAYERVKA
RFYRLGKSAYDAGIPVMIDAEESWLQAAIDDLATEMMREFNREKCIVINTVQMYRKDRHD
FLQKQFEQAEKENYFLGVKLVRGAYMEKERASADELGYESPIHDTKEDTDRNFNAALDFI
ISHIDRILLCSGSHNEESNAHLAQLMASHNIPKEHPHVLFSQLFGMGDHISFNLADKGYQ
VSKYVPYGPVKAVLAYLFRRAEENSSISGYVSRELRLLDKEMSRRHLPH
Download sequence
Identical sequences B3QSL4
gi|193215309|ref|YP_001996508.1| WP_012500145.1.43748 517418.Ctha_1603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]