SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193216082|ref|YP_001997281.1| from Chloroherpeton thalassium ATCC 35110

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|193216082|ref|YP_001997281.1|
Domain Number - Region: 45-106
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 
Domain Number - Region: 116-175
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0128
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193216082|ref|YP_001997281.1|
Sequence length 259
Comment protein PASTA domain-containing protein [Chloroherpeton thalassium ATCC 35110]
Sequence
MGFKSDFLTSKVAIQFYVTIFLLFTLAVLFDKVVMPFYVKGGDIVKVPEVAGLDFEAAKS
TLLKANLEPRLGYSRYDERYQLNAVLSQNPQAGEKVKAGRHVYLSVNTKNQPPSPLPDLR
GRTLADATLSLERIGLSVGTVTYSVVYKEDEDGIVLSQSVPPNALLKAGTPVSFSIGKMA
EEDGEKQSLIPDVTGRSLSEAQKLIVSSGYSLGKVSFRYSVALVPNTIIEQNPKQGEVAP
LGKPIDISVVTDDKSKASD
Download sequence
Identical sequences B3QX24
WP_012500916.1.43748 gi|193216082|ref|YP_001997281.1| 517418.Ctha_2384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]