SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|190570636|ref|YP_001974994.1| from Wolbachia endosymbiont of Culex quinquefasciatus Pel

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190570636|ref|YP_001974994.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.85e-29
Family 2Fe-2S ferredoxin-related 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|190570636|ref|YP_001974994.1|
Sequence length 115
Comment ferredoxin [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
Sequence
MPSVTFILPDGSKKSYEAAEGETLLNLAHRSDPDLLEGACEGSLACSTCHVIVDSKFYDV
VETHNPISDEENDMLDLAFGLTETSRLGCQIKITKDIDGLCVTVPRGTRNISLDK
Download sequence
Identical sequences A0A0U1D3Z4 A0A2A3TZN6 B3CNL7 B6Y834
WP_007302681.1.17329 WP_007302681.1.26101 WP_007302681.1.2611 WP_007302681.1.70878 WP_007302681.1.74056 WP_007302681.1.9798 570417.WPa_0178 gi|190570636|ref|YP_001974994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]