SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194337776|ref|YP_002019570.1| from Pelodictyon phaeoclathratiforme BU-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194337776|ref|YP_002019570.1|
Domain Number 1 Region: 15-205
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.02e-51
Family SOUL heme-binding protein 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194337776|ref|YP_002019570.1|
Sequence length 206
Comment SOUL heme-binding protein [Pelodictyon phaeoclathratiforme BU-1]
Sequence
MGGLSLLLMTSLMLAGCSVLGKRTASEPPFKVLEQHGDIEVRQYGEMIVAETVIEGAYGQ
TGAPGFSRLAGYIFGKNRSKEKLSMTAPVLQEQVSEKISMTAPVLQEKRGSAWVMAFVMP
EGSTLESLPVPLDPAVKLRSVQGKKVGVICYSGLHSESNLRNYAGKLTEWLEKKRFRVLS
QPRAASYDPPWTLPFLRRNEVHIDIE
Download sequence
Identical sequences B4SGW5
324925.Ppha_2804 WP_012509421.1.90574 gi|194337776|ref|YP_002019570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]