SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479199376|ref|YP_007828394.1| from Ruminococcus champanellensis 18P13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479199376|ref|YP_007828394.1|
Domain Number 1 Region: 118-268
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 6.02e-52
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.0000566
Further Details:      
 
Domain Number 2 Region: 2-117
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 5.56e-31
Family DHN aldolase/epimerase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479199376|ref|YP_007828394.1|
Sequence length 272
Comment dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Ruminococcus champanellensis 18P13]
Sequence
MDKIRIQNLTVFANHGVLPEERVLGQKFLISAELYLDTRAAGMQDDLTRTVNYAQVCSFI
CQQMQQTFQLIEAAAEHLAQGILREYPLVRRVDLELAKPWAPVHLPVESVSVQISRSWHR
AALSMGSNLGDSRAHLDAAVRALQSDPMCRSCRMSDYLVTRPVGYTEQPDFLNGAMVLDT
LYTPHELLDNLQRIEQSRHRERVIHWGPRTLDLDLIFYDDRIISDARLQVPHPEAANRFF
VLKPLSELAPYWMHPVLHRTVAQLLADNPEPV
Download sequence
Identical sequences D4L9U1
gi|479199376|ref|YP_007828394.1| WP_015557294.1.100417 WP_015557294.1.21076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]