SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449069558|ref|YP_007436639.1| from Sulfolobus acidocaldarius Ron12/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449069558|ref|YP_007436639.1|
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily LigT-like 3.49e-40
Family 2'-5' RNA ligase LigT 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449069558|ref|YP_007436639.1|
Sequence length 195
Comment 2'-5' RNA ligase [Sulfolobus acidocaldarius Ron12/I]
Sequence
MLRLFTGINVPNYEKINELMQAISRTGADIKLVEPWNIHITLVFIGEVHENKLELIKDGL
KRISFNKFKVRLHGTGAFPSLGKPRVVWVGIDEGAIELRMIRGSIYKELVNRGIRPDEEK
EFSPHLTIGRVRGPRNMQNLIQVINEYQGTDFGEFTVEKFTLYKSTLTQKGPIYEPLLEV
ESNVSGGESFRTNKT
Download sequence
Identical sequences A0A0U3FTT1 M1IVM3 M1J2L5 Q4J9A2
gi|449067287|ref|YP_007434369.1| WP_011278131.1.100797 WP_011278131.1.13097 WP_011278131.1.15291 WP_011278131.1.18585 WP_011278131.1.18739 WP_011278131.1.19907 WP_011278131.1.20267 WP_011278131.1.24072 WP_011278131.1.28054 WP_011278131.1.29213 WP_011278131.1.30898 WP_011278131.1.31299 WP_011278131.1.3283 WP_011278131.1.33024 WP_011278131.1.33782 WP_011278131.1.34459 WP_011278131.1.34536 WP_011278131.1.35781 WP_011278131.1.35800 WP_011278131.1.36276 WP_011278131.1.37881 WP_011278131.1.38112 WP_011278131.1.38253 WP_011278131.1.39308 WP_011278131.1.39398 WP_011278131.1.43265 WP_011278131.1.4394 WP_011278131.1.45682 WP_011278131.1.48356 WP_011278131.1.49892 WP_011278131.1.50721 WP_011278131.1.51246 WP_011278131.1.5150 WP_011278131.1.53520 WP_011278131.1.55288 WP_011278131.1.55517 WP_011278131.1.56706 WP_011278131.1.57256 WP_011278131.1.64117 WP_011278131.1.64360 WP_011278131.1.67449 WP_011278131.1.68798 WP_011278131.1.7301 WP_011278131.1.74875 WP_011278131.1.78046 WP_011278131.1.78998 WP_011278131.1.8042 WP_011278131.1.83345 WP_011278131.1.87279 WP_011278131.1.90653 WP_011278131.1.90680 WP_011278131.1.95134 WP_011278131.1.96274 WP_011278131.1.97501 330779.Saci_1287 gi|449069558|ref|YP_007436639.1| gi|70607052|ref|YP_255922.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]