SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294010682|ref|YP_003544142.1| from Sphingobium japonicum UT26S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294010682|ref|YP_003544142.1|
Domain Number 1 Region: 20-112
Classification Level Classification E-value
Superfamily YccV-like 3.14e-33
Family YccV-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294010682|ref|YP_003544142.1|
Sequence length 123
Comment hypothetical protein SJA_C1-06960 [Sphingobium japonicum UT26S]
Sequence
MNDMIQIFGPDVTAPPIVHARFSLGDVVQHRLFGFRGVVFDIDPVFANTEEWYQAIPEEV
RPDKHQPFYHLLAENGESSYVAYVSQQNLVADDSEEPVDHPAISGMFGTYANGKYQLRPL
HRH
Download sequence
Identical sequences A0A081SZG5 A0A0A1YAB7 A0A1L5BPL6 D4YYU8 T0HWL6 W1KJY1
WP_007688595.1.101124 WP_007688595.1.2244 WP_007688595.1.38124 WP_007688595.1.55674 WP_007688595.1.58499 WP_007688595.1.6240 gi|294010682|ref|YP_003544142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]