SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294012046|ref|YP_003545506.1| from Sphingobium japonicum UT26S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294012046|ref|YP_003545506.1|
Domain Number 1 Region: 83-222
Classification Level Classification E-value
Superfamily CBS-domain pair 5.94e-31
Family CBS-domain pair 0.0048
Further Details:      
 
Domain Number 2 Region: 224-310
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.91e-18
Family CorC/HlyC domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294012046|ref|YP_003545506.1|
Sequence length 315
Comment magnesium and cobalt transporter [Sphingobium japonicum UT26S]
Sequence
MAEGSPKDGNGSKESDSSSHEGGLWNGLKSLLFGDEESHSLRRELEDALDEYDEEEQEEG
ASPPAKGDLSAIERQMVRNLLHFSEHTVDDVAVPRADIIAIEENASFADLAALFAEAGHS
RIPVYRENLDTIVGMIHIRDAFAILAGKAPVPDRLEPLIRQPLYVPESMGALDLLAEMRA
KRTHLAIVLDEYSGTEGLLTFEDLVEEIVGEVEDEHDEEPEAMLVPLDGGLWEADARAEL
EDVAKEIDEKLAEVEEDVDTLGGLAFVIAGRVPEPGEIVEHAQSGWKLEILDSDGRRVSR
LRLHPPAEREMEEEG
Download sequence
Identical sequences A0A081T1H6 A0A0A1Y726 A0A1L5BM39 D4Z2R2 T0GZ31 W1KRZ2
gi|294012046|ref|YP_003545506.1| WP_007685013.1.101124 WP_007685013.1.2244 WP_007685013.1.38124 WP_007685013.1.55674 WP_007685013.1.58499 WP_007685013.1.6240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]