SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294012886|ref|YP_003546346.1| from Sphingobium japonicum UT26S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294012886|ref|YP_003546346.1|
Domain Number 1 Region: 213-345
Classification Level Classification E-value
Superfamily CBS-domain pair 2.28e-22
Family CBS-domain pair 0.0039
Further Details:      
 
Domain Number 2 Region: 355-435
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.54e-21
Family CorC/HlyC domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294012886|ref|YP_003546346.1|
Sequence length 438
Comment putative hemolysin [Sphingobium japonicum UT26S]
Sequence
MANIPPHAPTPFPWVDLVIILALVALNGLFAMSELAIVSARRPRLQAMEKAGRRGARSAL
AAASDPGKFLSTVQIGITLIGIVAGAYSGASLGGPTGERLQMLGLSPNAAQNAGFALVIG
LTTYASLIVGELVPKQFALRAPEPIAVLVAGPMLWLAKLTAPIVWLLDGSSALIFRLLRM
TRESEQHVTAEELHLIVAEASRSGVIEESERAIISGVVRLADRPVREVMTQRMDVDWIDI
HADEDAIRAKLLDTPHTRLPVGRGTVEDIIGVVQARDIMTALFRGEGLNLETLMRKVEVV
PDQVDAMDALEVLRRAEVPMVMVHDEYGHFEGIATPADLLSAIAGHFVSDLDSADEPELV
EREDGSLLVSGQMPVDLLADRIGIDLPEDRDYATVAGHALWLLKRLPEVGDFIDDQGWRF
EIVDMDGRKIDKLLIAER
Download sequence
Identical sequences A0A081T4G0 D4Z552 T0HGK1 W1KI12
gi|294012886|ref|YP_003546346.1| WP_013041036.1.2244 WP_013041036.1.38124 WP_013041036.1.58499 WP_013041036.1.6240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]