SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435850746|ref|YP_007312332.1| from Methanomethylovorans hollandica DSM 15978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435850746|ref|YP_007312332.1|
Domain Number 1 Region: 1-215
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.9e-55
Family Phosphate binding protein-like 0.00016
Further Details:      
 
Domain Number 2 Region: 218-289
Classification Level Classification E-value
Superfamily GlnB-like 2.45e-20
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|435850746|ref|YP_007312332.1|
Sequence length 290
Comment ATP phosphoribosyltransferase [Methanomethylovorans hollandica DSM 15978]
Sequence
MIEIAIPKGSLEEQTLLLFKQADLEIKKTDRQYNPTINDPRIKKVKILRPQEIPRYVHDG
YFDLGISGLDWVTESSSDVVEVADLPYSKQGSGNVKIVIAVPQESDIRSAKDIKPGSRVS
TEYPKMTQKFFDDLNIPVEIHFSYGATEAKVPDLMDVVVDLTETGSTLRRNGLKIVDQIM
ESSTKLIANKKSWQDPLKRREIEEIRTLLLSVIEARGKVLLDMNVPCDKLDAIIDFLPSM
KRPTVSQLYKSDYYAVETVVSKNEVNLLIPRLKALGAEDILEMDISKIVR
Download sequence
Identical sequences L0KTS7
WP_015323971.1.68990 gi|435850746|ref|YP_007312332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]