SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|435850827|ref|YP_007312413.1| from Methanomethylovorans hollandica DSM 15978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435850827|ref|YP_007312413.1|
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.78e-43
Family SOUL heme-binding protein 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|435850827|ref|YP_007312413.1|
Sequence length 165
Comment SOUL heme-binding protein [Methanomethylovorans hollandica DSM 15978]
Sequence
MSVKKAEYTVLRVLGEGVEIRQYPKQTLISTDAKDKDTAFSILANYIFGGNSEGIRISMT
TPVTTVLSDNGLQMSFVLPLGYYADNAPNPRDERITIRDLDPRKIATTRFSGYLNKEKYV
QKKHELTEILKLESIAVKGDAFMMQYDPPWVIPMLRHNEVAIEVE
Download sequence
Identical sequences L0KXU0
gi|435850827|ref|YP_007312413.1| WP_015324051.1.68990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]