SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435850985|ref|YP_007312571.1| from Methanomethylovorans hollandica DSM 15978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435850985|ref|YP_007312571.1|
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily Influenza hemagglutinin (stalk) 0.0000419
Family Influenza hemagglutinin (stalk) 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|435850985|ref|YP_007312571.1|
Domain Number - Region: 52-177
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0288
Family HBL-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|435850985|ref|YP_007312571.1|
Sequence length 210
Comment hypothetical protein Metho_0794 [Methanomethylovorans hollandica DSM 15978]
Sequence
MTTEGDGVGVTLLGREGLIDAVILKHNRMLEKYNFEFEELDTRFSSCSREIDNIKKEHEE
LLERIDVLKEKRQQLYHQAEITLEKLIGSDMQQKDVDTIRDSIIKAKSISSEDEEKAVVA
SILSLLAGGETSEIKSSIESKIAEALAAHEEFISISGRENTLTEDKKLHEEELNKAKPRH
SWLENRIQSHKEALKHWENLKNVKEEEIIA
Download sequence
Identical sequences L0KV75
WP_015324208.1.68990 gi|435850985|ref|YP_007312571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]