SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|435851384|ref|YP_007312970.1| from Methanomethylovorans hollandica DSM 15978

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|435851384|ref|YP_007312970.1|
Domain Number - Region: 13-56
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0358
Family Nanomeric phage protein-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|435851384|ref|YP_007312970.1|
Sequence length 149
Comment hypothetical protein Metho_1210 [Methanomethylovorans hollandica DSM 15978]
Sequence
MTKSHTAKPIVFKWTPARIKGAKLAASTTMTQEEIAKECSVHRMTVNEWFQAQEFKEKVA
ELIMQDERFTRPGLLKITGAILDKKIERAAEDRSTAADYIKIVADIAGINKAGNEINIYN
AVGVVNTQEVKDAVSRLCEKLREADDSTD
Download sequence
Identical sequences L0KXM1
WP_015324606.1.68990 gi|435851384|ref|YP_007312970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]