SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435851676|ref|YP_007313262.1| from Methanomethylovorans hollandica DSM 15978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435851676|ref|YP_007313262.1|
Domain Number 1 Region: 122-243
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 7.32e-20
Family MJ1460-like 0.015
Further Details:      
 
Domain Number 2 Region: 16-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000395
Family ArsR-like transcriptional regulators 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|435851676|ref|YP_007313262.1|
Sequence length 248
Comment putative hydrocarbon binding protein (contains V4R domain) [Methanomethylovorans hollandica DSM 15978]
Sequence
MNDSDRTALFSNGNGFVALNSPVKIEILDFLKVSTRSFDEIVKHTGKAKSTISVHLNDLR
SFGLVEEECDQNDKRRKAYHLKCEHMAHSQPPILRHYKNVLETLASPQLEKHGCFKCFFR
AIQFGFDAHGINSDPIMRKIGRDIGTSISSNFTSKDIKFLVQELAEFWKRYQMGTMYLVN
SEPLVIAVEKCFDYKLISTIGKNLCSFTEGIIEGTIVHSLNISCCVQEIECCGNGKERCL
FIVHFLNK
Download sequence
Identical sequences L0KWA2
gi|435851676|ref|YP_007313262.1| WP_015324897.1.68990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]