SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|435849842|ref|YP_007301783.1| from Methanomethylovorans hollandica DSM 15978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435849842|ref|YP_007301783.1|
Domain Number 1 Region: 310-412
Classification Level Classification E-value
Superfamily PKD domain 2.09e-29
Family PKD domain 0.00011
Further Details:      
 
Domain Number 2 Region: 494-654
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.35e-24
Family Bacterial lipase 0.063
Further Details:      
 
Domain Number 3 Region: 905-1012
Classification Level Classification E-value
Superfamily PKD domain 4.45e-24
Family PKD domain 0.00014
Further Details:      
 
Domain Number 4 Region: 43-266
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 7.85e-18
Family SGL-like 0.075
Further Details:      
 
Domain Number 5 Region: 1309-1396
Classification Level Classification E-value
Superfamily PKD domain 6.67e-17
Family PKD domain 0.0034
Further Details:      
 
Domain Number 6 Region: 1218-1304
Classification Level Classification E-value
Superfamily PKD domain 2.62e-16
Family PKD domain 0.0038
Further Details:      
 
Domain Number 7 Region: 1600-1686
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000119
Family PKD domain 0.0028
Further Details:      
 
Domain Number 8 Region: 413-493
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000183
Family PKD domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|435849842|ref|YP_007301783.1|
Sequence length 1881
Comment PDK repeat-containing protein [Methanomethylovorans hollandica DSM 15978]
Sequence
MESKYVNKIRTTSILLSILFFVLMSSPIVHAETYSLVKQWGSTGNSTGQFNNPSAVTVDS
YGNVYVADANNYRIQKFDNNGAFINSFETWYKSQFHIHPRGVAVDSSGYIYTSGCGGNGG
IAGAAYGIRYGTVYHKYDNNGNLVSEVYPNGAMGFYYSVYLPWETAVDKFGNVYVSDVTN
GYVDKFNNGICMSAFQNRSISGSDSKFSIDSLGNYYIIYGGFINKFDSNGNFITKIGSSG
SGDGQIRDPVAVAVDDSGNIYVVDCQQKDYTLKEYYRIEVFDTNYKFITQWQLSSNFSNI
YNSDIAVDSTGNVFVVESYNNRIYKYAPTNSVNPAANFTSNITEGYTPLSVKFTDTSTGS
PTSWLWDFGDGNTSTEQNPTYTYYKSGNYTVTLTASNSEGTDSTSQTISVNDIDFKVNPQ
KIRISDKVEFNASQYISSTGGGITWDFGDGKTDLSNNPIVYHNYSEPGSYTAKITITDSK
GNVATKSQFVNVTIPVVLVHGFMSSSETWVDMSSALQKNGFEVWNFDYGIYSTQNPQDIA
PKLSDFIEGKRNDLTYNGQKYNGKIDIVCHSMGSIVSRLYMEHYQGGIHGKDVRQWIGIA
PAHGGSAGADIYIPVGQVKSQILLNFMQATPPEYYAFYQQIGLAVNELKTDSNSVKSLAS
GSLSPTTKYRVLVGWNPTHSSQFGGNLLSATLAKNTSRPDPYYWTDSGDMIVATAQSYDQ
RIKNFEAFPINGNLGDSPAEEFDHIHIIKSPTVIQYVIDCLKDINKPSSNKLPPDNEVSF
LTVVNRDIKGYIGTKAQQVTGYLGTKVQQIKFFVSGFFSMGSDSISNLRVESNSITIDQE
TSSSQEKVLSILLEWDEGDIAVNLMSPSGIEYSAESHPYNVWYLKEGKLLYYIITDPESG
NWTVNLIPEEYPGHDMHYNLTYWVEDSNSGVLNGFPVANFSTNITTGYVPLTVQFTDLSE
NATSWKWDFGDGAASTEQDPLHIYTKEGNYTIVLNSSNSIGYSTKQTTIAVKSNSASTST
ASYAPTYDNRLRSASPTSVLSTTTYLDIGRSSATVRDVMLFDLSSYKTTDTISKATLSLY
WYYPAGATRTSDTVVEVYRPVEWDPKYVTWNSRASGVSWTTAGGSWYDKNAVSQGTTPYA
SITFPASTVPDNKYYDFDVTQLVQEYVSGKYKNTGFFLKAKTESGNYIAFYSAEASNTAV
RPKLTVTSTSGSTAVDNLPVANAGADKTAMAGSTVIFNASASTDDKGIASYSWDFDLSNG
ITAEATTMTASHIYPVAGTYTATLTVIDTSGQVSTDTVQVTVSEMSVDNPPIANAGIDKT
VTVGSSVTFDGSASTDDKGIASYSWDFDLSNGITTEATTMAASHIYASPGTYTVTLTVTD
TAGHVATDTLQVVVSSATSTTTASYSPTYDNRLRSASPTSVLSTTTYLDIGRSSATVRDV
MLFDLSSYKTTDTISKATLSLYWYYPAGSTRTSDTIVEVYRPVEWDPKYVTWNSRTSGTL
WTTVGGNWYDKNAVSQGTTPYASATFAAGTIPDNKYYDFDVTQLVQEYVSGKYKNTGFFL
KAKTESGNYIAFYSAEASNTAVRPKLTITSASGSTTVDNLPVANAGADKTATVGTSVTFD
ASASTDDKGIASYSWDFDLSNGITAEAATMIASKTYTATGTYTVTLTVTDTVGQKSTDTV
QVVVSSASSPVSTVSYTPTYDNRLRSASPTSVLSTTTYLDIGRSSATVRDVMLFDLSSYK
TTDTISKATLSLYWYYPVGTTRTSDTVVEVYRPVEWDPKYVTWNSRMSGVSWTTAGGSWY
DKNAVSQGTTPYASVTFTGTKLPDNKYYDFDVTQLVQEYVSGKYKNTGFFLKARTESGNY
IAFYSLESSNAAVRPKLTITS
Download sequence
Identical sequences L0L1E5
gi|435849842|ref|YP_007301783.1|NC_019972 WP_015313887.1.68990 gi|435849842|ref|YP_007301783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]