SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556558044|ref|YP_008727579.1| from Bacillus amyloliquefaciens CC178

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556558044|ref|YP_008727579.1|
Domain Number 1 Region: 1-253
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.64e-70
Family Phosphate binding protein-like 0.0000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|556558044|ref|YP_008727579.1|
Sequence length 255
Comment yqiX [Bacillus amyloliquefaciens CC178]
Sequence
MKKWLLVLAAACITFALSACGSGNSGSEGGKNKLIMGTSADYKPFEYKDGDQITGFDVDL
AKALGKKTGYDVEVQDMDFNSLITALKSKQVDMILSGMTPTPERKKQVDFSDIYYTANNM
IVTKKGSSMKSLNDLKGKTVGVQLGSIQEEKGKKLASKYGFQLEDRNRISDLTEEIKSGR
FDAAIIEDIVAQGYFSSNQDLQGFASADAKSDESGSAIAFRKDSDLTAKFNKALKEMEKN
GEIEKLKKKWFTNEK
Download sequence
Identical sequences A0A142F691 A0A2D1I1X6 A7Z6G3 S6FYF2
gi|556558044|ref|YP_008727579.1| 326423.RBAM_022280 gi|154686659|ref|YP_001421820.1| WP_007408386.1.10180 WP_007408386.1.10479 WP_007408386.1.14108 WP_007408386.1.17514 WP_007408386.1.29703 WP_007408386.1.37381 WP_007408386.1.37657 WP_007408386.1.42579 WP_007408386.1.44318 WP_007408386.1.48095 WP_007408386.1.52720 WP_007408386.1.52960 WP_007408386.1.53942 WP_007408386.1.58329 WP_007408386.1.62170 WP_007408386.1.67719 WP_007408386.1.68293 WP_007408386.1.6973 WP_007408386.1.80280 WP_007408386.1.8147 WP_007408386.1.85444 WP_007408386.1.86493 WP_007408386.1.89937 WP_007408386.1.90093 WP_007408386.1.98151 gi|530570129|ref|YP_008413344.1| gi|452856166|ref|YP_007497849.1| gi|530614915|ref|YP_008421576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]