SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556558152|ref|YP_008727687.1| from Bacillus amyloliquefaciens CC178

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556558152|ref|YP_008727687.1|
Domain Number 1 Region: 46-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.31e-73
Family Phosphate binding protein-like 0.0000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|556558152|ref|YP_008727687.1|
Sequence length 300
Comment phosphate-binding protein pstS 1 PBP 1 [Bacillus amyloliquefaciens CC178]
Sequence
MKKNKWMLMLLMAAVMIVAAACGNAKESGKTDSQSASEDKKASGSLTISGSSAMQPLVLA
AAEKFMEKHPDADVQVQAGGSGTGLSQVSEGAVQIGNSDVFAEEKEGIDAKALKDHRVAV
VAMAAAVNPGAGVKDITKKQLTDVFTGKIKNWKELGGKDQKITLVNRPDSSGTRATFVKY
ALDGAEPAEGITEDSSNTVKKIIAETPGAIGYLAFSYINDDKVTPLSIGGIKPEEKNVVT
GEYPIWAYEHSYTKGEASGLTKTFLDYMNSDEVQKSIVKDQGYIPISDMKVTRDANGKQS
Download sequence
Identical sequences A0A1N7GIL1 A0A2G7TRM6 A7Z6R3
WP_012117998.1.11256 WP_012117998.1.24336 WP_012117998.1.27978 WP_012117998.1.3071 WP_012117998.1.36989 WP_012117998.1.37381 WP_012117998.1.37657 WP_012117998.1.39952 WP_012117998.1.44318 WP_012117998.1.44634 WP_012117998.1.52667 WP_012117998.1.55276 WP_012117998.1.5788 WP_012117998.1.58329 WP_012117998.1.72986 WP_012117998.1.75310 WP_012117998.1.78242 WP_012117998.1.80280 WP_012117998.1.80690 WP_012117998.1.85402 WP_012117998.1.89039 WP_012117998.1.90093 gi|154686759|ref|YP_001421920.1| gi|556558152|ref|YP_008727687.1| gi|375363032|ref|YP_005131071.1| 326423.RBAM_023290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]