SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556558831|ref|YP_008728366.1| from Bacillus amyloliquefaciens CC178

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556558831|ref|YP_008728366.1|
Domain Number 1 Region: 29-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.21e-76
Family Phosphate binding protein-like 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|556558831|ref|YP_008728366.1|
Sequence length 271
Comment D-methionine-binding lipoprotein metQ [Bacillus amyloliquefaciens CC178]
Sequence
MKKIVLSALLLVFAGVLAACGSNGSNKKEIVVAATKTPHAEILKEAEPLLKEKGYTLKVK
VLNDYKMYNKALADNEVDANYFQHVPYLEQEMKENKDYKLVNAGAVHLEPFGIYTKKYKS
LKDLPKGATIIMTNNVAEQGRMLAMLEKAGLITLDPKVKTIEATTKNITKNPKNLTFKKI
APELTAKAYNEEEGDAVFINVNYAIQNKLNPLKDAIQVESTKNNPYANIIAVRKGDEKSE
KIKALMEVLHSKKIKDFIEKKYDGAVLPVSE
Download sequence
Identical sequences A0A0D7XTV8 A0A142F875 A0A1N7F6I5 A0A2D1HTH4 A7Z8I6
gi|154687382|ref|YP_001422543.1| gi|451345596|ref|YP_007444227.1| WP_012118382.1.101182 WP_012118382.1.17514 WP_012118382.1.17976 WP_012118382.1.18446 WP_012118382.1.21189 WP_012118382.1.23363 WP_012118382.1.23850 WP_012118382.1.3136 WP_012118382.1.34580 WP_012118382.1.37657 WP_012118382.1.44318 WP_012118382.1.53492 WP_012118382.1.54902 WP_012118382.1.55959 WP_012118382.1.57138 WP_012118382.1.58329 WP_012118382.1.58623 WP_012118382.1.61562 WP_012118382.1.66543 WP_012118382.1.6973 WP_012118382.1.77593 WP_012118382.1.78914 WP_012118382.1.80280 WP_012118382.1.8147 WP_012118382.1.83568 WP_012118382.1.85402 WP_012118382.1.86493 WP_012118382.1.87529 WP_012118382.1.92694 WP_012118382.1.97374 gi|429506549|ref|YP_007187733.1| 326423.RBAM_029810 gi|556558831|ref|YP_008728366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]