SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556558906|ref|YP_008728441.1| from Bacillus amyloliquefaciens CC178

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556558906|ref|YP_008728441.1|
Domain Number 1 Region: 38-263
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.82e-67
Family Phosphate binding protein-like 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|556558906|ref|YP_008728441.1|
Sequence length 265
Comment hypothetical protein U471_31650 [Bacillus amyloliquefaciens CC178]
Sequence
MLKKKATLLTTAAMAVFLATAGCSSGQSSKGGQNEKVTLTVSAAASAQDALEEIQTNYEK
SHSNVTIQDNFGSSGTLQKQISQGAGADLFFSAAEDKFEKLVHDGDIDKKDSTDLLKNDL
VMIVPEKNSAHLTHLNDLKKDSAEKIALGTPESVPAGQYAKQSLTTLSLWDKVKDKVVYA
KDVRQVLSYVETGNVDAGLVYKTDALISKKVKITDEAPAKTHDPIVYPVGIVKDTKHRKE
AEAFYQYLQSDEAMKVFKKYGFTAK
Download sequence
Identical sequences A7Z8Q5
gi|154687451|ref|YP_001422612.1| 326423.RBAM_030500 WP_012118429.1.3136 WP_012118429.1.37657 WP_012118429.1.44318 WP_012118429.1.61562 WP_012118429.1.80280 gi|556558906|ref|YP_008728441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]