SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556558940|ref|YP_008728475.1| from Bacillus amyloliquefaciens CC178

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556558940|ref|YP_008728475.1|
Domain Number 1 Region: 3-231
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.27e-50
Family Phosphate binding protein-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|556558940|ref|YP_008728475.1|
Sequence length 238
Comment hypothetical protein U471_31990 [Bacillus amyloliquefaciens CC178]
Sequence
MQTVIVGTGTDFPNIAFMDEKGELTGYDIEVMKAIDKQLPQYKFVFKTMDFSNLLTSLGN
RKIDVIAHNMAKNKEREKRFLYHKIPYNYSPMYITVKADNDAIHTLRDLKGKTVIVGATS
NAADYMTAYNKTHGSPIHLKYAGQGSSDTANQMETGRADATVSTPFAVDFQNKTHAFKQK
TVGDVLLDTEVYFMFNKNSQTLADDTDRAIQKLEKDGTLKRLSEKWLGADYSKSSFTK
Download sequence
Identical sequences A7Z8T9
gi|556558940|ref|YP_008728475.1| gi|154687485|ref|YP_001422646.1| 326423.RBAM_030840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]