SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188995032|ref|YP_001929284.1| from Porphyromonas gingivalis ATCC 33277

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188995032|ref|YP_001929284.1|
Domain Number 1 Region: 238-392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-24
Family ABC transporter ATPase domain-like 0.00062
Further Details:      
 
Weak hits

Sequence:  gi|188995032|ref|YP_001929284.1|
Domain Number - Region: 33-88,122-217
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000981
Family DNA repair protein MutS, domain III 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188995032|ref|YP_001929284.1|
Sequence length 463
Comment DNA mismatch repair protein MutS [Porphyromonas gingivalis ATCC 33277]
Sequence
MKLREQINSISGFRYVIDELCIHSSVGRRCLMEQEFLTEASDIEVLLSRVEIAISYQADQ
RKQKGLDEIAHKLMQLRDIQGTIYSLSRHVVCTDIDFFEIKFLAILSEDIRDLIRFYQLD
DLSSPLPDLSQIVSVLDPEEKRIPHFYIYDAYSETLRELRDRLKKETNEDARIEIRNESL
QEEDIVRKRLSRELSPYAGGLATALELLGAIDLLLAKVKLFIQLGWSKPGSGHSVTNYMG
LVHPHVLSLLGKKGEKFQPVDIALPSLPTLITGANMAGKSVLLQGVALAQILYQYGFYVP
AQKAEICPVEKVMLSLGDAQDIRQGLSSFGAEMMCLSSIADEARQGKQLLVLVDEPARTT
NPVEGQAIVSGLLAILSRYKIRSLVTTHYGSIDIPCRRLKVRGFREDKVNLPLHVNSLSK
CVDYTLEEVSENDVPHEAIRIAEILGVNEALMTECKQFLNNTK
Download sequence
Identical sequences B2RJZ2
431947.PGN_1168 gi|188995032|ref|YP_001929284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]