SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188995445|ref|YP_001929697.1| from Porphyromonas gingivalis ATCC 33277

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188995445|ref|YP_001929697.1|
Domain Number 1 Region: 303-530
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-38
Family ABC transporter ATPase domain-like 0.00047
Further Details:      
 
Domain Number 2 Region: 24-300
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 8.11e-22
Family DNA repair protein MutS, domain III 0.016
Further Details:      
 
Domain Number 3 Region: 765-838
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000144
Family Smr domain 0.006
Further Details:      
 
Weak hits

Sequence:  gi|188995445|ref|YP_001929697.1|
Domain Number - Region: 519-617
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0785
Family BAR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188995445|ref|YP_001929697.1|
Sequence length 840
Comment DNA mismatch repair protein MutS [Porphyromonas gingivalis ATCC 33277]
Sequence
MIRMETYPHNFEEKVGFDEIRRLLIGRCHSPMGSDRVMQMHALARHDEVSRLLAETEEMQ
IILREEDLFPDLRLADVREALNRIRPAGTYLEEPELLDVATALRTIEALIRFFHVGEEEE
GKDTPYPHLQTLLSEVIAFPDLEKRISSLFDRFGKMKDNASPELMNIRRELSSIEKNISR
TLQGILRLAQSEGWVDQGVQPSVRDGRLVIPVAPAHKRKVRGIVHDESGTGKTVFIEPAE
IVEANNRIRELEAAERREIIRILIEVCDALRPHIHDLIDCYEWIGLFDFISAKARLCGEW
NAIRPILSKKPEIRWEKAVHPLLLRSLRAHGRDVIPLDISLTAPDKRILVISGPNAGGKS
VCLKTVGLLQYMLQSGLPIPMSPDSTAGIFGKLFIDIGDEQSIEDDLSTYSSHLRNMKHF
ARHTDKSTLLLIDEFGGGTEPQIGGAIAEALLHRFNEQEGFGVVTTHYQNLKAYAEETPG
LVNGAMLYDRHEMRPLFRLSIGRPGSSFAIEIARKIGLPEEVIAEATDKVGTGYIDMDKY
LQDIVRDKRYWETKRTNIRKEEKRLEGAAAEYESRLESIKKERKQILDEARQQASEMLSQ
SSAQIEKTIRDIKEAQAEREKTRRARQELSDFKETINKEEIEKEERINREIEKIKRRKKR
KQEKVASRSVETPVQPKLQEVPQLPAIRVGDTVRIKGQTAIGSIIDMNDREATIALGMIK
TTVPIDRLEPAKPVKERKSEPVSGASARMIIDRIHEKRLDFNQDIDLRGMRVNEAVQAVM
YFIDDAIQLGIPRVRILHGTGTGALRTVIREYLATVNGVRHFADEHVQFGGAGITVVELG
Download sequence
Identical sequences B2RL55
431947.PGN_1581 WP_012458385.1.22673 WP_012458385.1.48852 WP_012458385.1.79666 WP_012458385.1.99922 gi|188995445|ref|YP_001929697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]