SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188995793|ref|YP_001930045.1| from Porphyromonas gingivalis ATCC 33277

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188995793|ref|YP_001930045.1|
Domain Number 1 Region: 7-74
Classification Level Classification E-value
Superfamily AF1862-like 0.0000288
Family Cas Cmr5-like 0.013
Further Details:      
 
Weak hits

Sequence:  gi|188995793|ref|YP_001930045.1|
Domain Number - Region: 88-125
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.0719
Family Prokaryotic type KH domain (KH-domain type II) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188995793|ref|YP_001930045.1|
Sequence length 145
Comment hypothetical protein PGN_1929 [Porphyromonas gingivalis ATCC 33277]
Sequence
MNKKTIQDLIPKAMQAIEGVGIVGKDKKFEKVHEGYINALGPNIIQSGLLPTLIFYNKDE
RALWLRALYYMAVDGEEKMTDESSTAIIRLIIGKEGGRIENLKPKAKEWERKILEYAVAL
KLALRTFVAKESETGNTEQQKGGAQ
Download sequence
Identical sequences B2RM53
WP_012458615.1.22673 WP_012458615.1.48852 WP_012458615.1.79666 WP_012458615.1.99922 431947.PGN_1929 gi|188995793|ref|YP_001930045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]