SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188995905|ref|YP_001930157.1| from Porphyromonas gingivalis ATCC 33277

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188995905|ref|YP_001930157.1|
Domain Number 1 Region: 259-556
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.35e-78
Family DNA repair protein MutS, domain III 0.00000229
Further Details:      
 
Domain Number 2 Region: 558-794
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.19e-55
Family ABC transporter ATPase domain-like 0.00000109
Further Details:      
 
Domain Number 3 Region: 1-104
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.09e-36
Family DNA repair protein MutS, domain I 0.000057
Further Details:      
 
Domain Number 4 Region: 105-258
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 3.01e-36
Family DNA repair protein MutS, domain II 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188995905|ref|YP_001930157.1|
Sequence length 882
Comment DNA mismatch repair protein MutS [Porphyromonas gingivalis ATCC 33277]
Sequence
MMRQYFQIKQKHPDAILLFRVGDFYETFSEDAIVASEILGITLTRRANGAAQFVELAGFP
HHALDTYLPKLVRAGKRVAICDQLEDPKKTKTLVKRGITELVTPGVSTNDNVLSHKENNF
LAAVSCDKEVFGISLLDISTGEFMAGQGNADYVEKLLTNYRPKEILVERSERSRFNDLFH
WSGFIFDMEDWAFSSENNRLRVLKHFDLKSLKGFGLEELSMAVTAAGAVLNYLDLTQHHQ
LQHITSLSRLDENRYVRLDKFTVRSLELLSPMNEGGKSLLDIIDHTITPMGARRMRQWIV
FPLKDPARIQARQRVVEFFFRHPEERAIIAEHLTEIGDLERLVTKGAMGRISPREMVQLR
IALQALEPIKEVCTQADEENLRTLGGKLELCKELRDKILREVMPDAPAALGRGPVIAHGV
DATLDELRALAYSGKDYLIKLQQQEIERTGIPSLKVAYNNVFGYYIEVRNTHKDKVPAEW
IRKQTLVSAERYITEELKEYEAKILGAEEKIAALEGQLYALLVAELQRYVAPLQQDSQAV
ASLDCLLSFAESARRYRFICPVVDESFTIDIKAGRHPVIEQQLPADEPYIANDIYLDTDR
QQVIIVTGPNMSGKSALLRQTALISLMAQIGSFVPAESARIGMVDSIFTRVGASDNISMG
ESTFMVEMQEASNILNNLTPRSLVLFDELGRGTSTYDGISIAWSIVEYIHDNPKAHPRTL
FATHYHELNELEGQLDRVHNFNVSAREVDGKMLFLRKLEPGGSAHSFGIQVARLGGMPHH
IVQRATDILHRLEQERERIEGEEPKTKDTKRGPSEKVKNASPTLPRDEKGRSIDGYQLSF
FQLDDPVLSQIREEILDLNIDNLTPLEALNKLNDIKRILRGY
Download sequence
Identical sequences B2RMG5
gi|188995905|ref|YP_001930157.1| 431947.PGN_2042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]