SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193216635|ref|YP_001999877.1| from Mycoplasma arthritidis 158L3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193216635|ref|YP_001999877.1|
Domain Number 1 Region: 158-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.44e-46
Family G proteins 0.000019
Further Details:      
 
Domain Number 2 Region: 2-155
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 3.92e-46
Family Obg GTP-binding protein N-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 349-420
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 0.000000000000157
Family Obg GTP-binding protein C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|193216635|ref|YP_001999877.1|
Sequence length 422
Comment GTPase ObgE [Mycoplasma arthritidis 158L3-1]
Sequence
MKFIDEVNVLVKAGKGGDGIISFRREANVDRGGPDGGNGGRGGNVYFRGDSGLNTLLAFH
YQNKISAKDGESGKPKNAYGAAGADEIVKVPLGTLVYYEDNLIADVIEPKDYLIAKGGRG
GRGNLMFKSAKNTAPRICENGESGEKFALRLVLKVLADVGLVGKPSAGKSSLLNALSNAK
AKTADYDFTTLVPQLGMLKYYDKSCTIADLPGLIAQASEGKGLGFQFLKHIERCKVIAHV
IDFGSSLKDPILDYETIKKELKDYNLNLEALPHVIIANKSDQEIFATNLKKFKKAYPTLP
IVAISALYQKNLDELKAAIFKMLEQANQQTKSNVVENEIAINITLDRDALKIRKLSENVY
EIESKKVLNVVEKIPVSSLDNLWRINNKLKKLGVFELIKKHNVPEGATIKIGNFEFDWSD
EE
Download sequence
Identical sequences B3PMC1
243272.MARTH_orf270 WP_012498130.1.28547 gi|193216635|ref|YP_001999877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]