SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193216744|ref|YP_001999986.1| from Mycoplasma arthritidis 158L3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193216744|ref|YP_001999986.1|
Domain Number 1 Region: 146-225
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.34e-23
Family Translational machinery components 0.00035
Further Details:      
 
Domain Number 2 Region: 74-143
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.15e-22
Family Ribosomal S5 protein, N-terminal domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193216744|ref|YP_001999986.1|
Sequence length 234
Comment 30S ribosomal protein S5 [Mycoplasma arthritidis 158L3-1]
Sequence
MTSQDNIKDILEKGKIPTKEEASAAVKAKKAAPTKIVAAKETSTNAPKTRENATKDGQSR
PHRSFSKPRQDFREHPEFEEKVVDVARVTTVVKGGRRFSFSAYVVVGDKKGKVGFGHGKA
NEVQDAIKKAVKDAQKNIIVVPIIKGTIPHEIKEKFVASKVQLRPAPKGAGIIASGTVRA
VVELAGYTDISTKTYGSRTKQNIVQATINALKKVRTVEEIAKLRNVDVKHLLEK
Download sequence
Identical sequences B3PMN0
gi|193216744|ref|YP_001999986.1| 243272.MARTH_orf423 WP_012498239.1.28547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]