SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193216929|ref|YP_002000171.1| from Mycoplasma arthritidis 158L3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193216929|ref|YP_002000171.1|
Domain Number 1 Region: 49-120
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.0000000107
Family Glucose permease domain IIB 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193216929|ref|YP_002000171.1|
Sequence length 126
Comment glucose/sucrose specific PTS system IIB component [Mycoplasma arthritidis 158L3-1]
Sequence
MSKKNKLKYVLLIIFTLGLICIYWRFKYRQVEKKDYLTVEHTLAFSFDELMNLIGSKDNI
DNVSATQKIIKIYFKERSKVNLTGIQKLPGISGISFQSKAISLVIGNSAKYLEELILKEL
DFNERS
Download sequence
Identical sequences B3PN65
243272.MARTH_orf702 gi|193216929|ref|YP_002000171.1| WP_012498424.1.28547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]