SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193216954|ref|YP_002000196.1| from Mycoplasma arthritidis 158L3-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193216954|ref|YP_002000196.1|
Domain Number 1 Region: 12-155
Classification Level Classification E-value
Superfamily RNase III domain-like 3.66e-34
Family RNase III catalytic domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 111-217
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.83e-16
Family Double-stranded RNA-binding domain (dsRBD) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193216954|ref|YP_002000196.1|
Sequence length 222
Comment ribonuclease III [Mycoplasma arthritidis 158L3-1]
Sequence
MLERNGLDIKKIRRPEFVFKSLTHKSFDQSDHFKFNYEYLEFLGDAVLEFYTSDRIFQNF
PKYTEGEATRHRQMIVSNENLAKIAHKIGLVEIARFGKKVFEEIKNIPNSKVFSDMFESF
IGALYFGLGIGPTFQYLDSVLLDSVLNVIDSKDPKSYFQEIIQANGNLSRLRYVTVAQNN
GEFKSELLVDQKVFGVGYGHSKKQAEKAAAISALKKMETSNF
Download sequence
Identical sequences B3PN90
243272.MARTH_orf739 gi|193216954|ref|YP_002000196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]