SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188592148|ref|YP_001796746.1| from Cupriavidus taiwanensis LMG 19424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188592148|ref|YP_001796746.1|
Domain Number 1 Region: 394-435,475-535,583-800
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.07e-80
Family Acetamidase/Formamidase-like 0.00018
Further Details:      
 
Domain Number 2 Region: 276-329
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000762
Family AraC type transcriptional activator 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188592148|ref|YP_001796746.1|
Sequence length 803
Comment transcriptional regulator AraC family [Cupriavidus taiwanensis LMG 19424]
Sequence
MSAAPALWQSDAREAPLHLQRFSTEAYPRNRRGAAWRDELRAARLQCESLCADHTLHGTI
QSRTTPAGIGLTCIASVPQTLAITAGDGRGLMLLMLTEGEAHLASPDLREPLRPGQVVCV
PEHAARKVALTTAFRLLTVHIGQALLNARITAPLPRSALVLGGDAAELFARLLQSMAASI
DTLVSADDRAVQPFDSTIVACLGAALADNQPSAPADMTPSRAAVFARVCSRIDARLAEPE
LSLAAIAADEHMSARYLQKLFEKSGSSFSAYLRTSRLERCRADLANAQYDKLSVSDICYR
WGFNDPSHFSHAFREQFGISPRAYREQAVGMPAQRPPLNVSRGLPPDARRGPAQQRAPAN
DIARARALPAPSVVPITQARSHAARPEGRHHWLQATDKTVHWGYLSHELPPVLEVMSGDT
VTIETLTQHASDDRERMIDGDPGAESVFHWTAEQKNVDRRGAGPIDASVYGRGAGEGFGV
HICTGPVAVRGAMPGDVLEVRILDVRPRPCANPRFAGRAFGSNAATWWGFHYRDMLTEPR
EREVVTVFEIDCERADGCARAVYSFRWTPQRDPFGVLHPTIDYPGVPVDHDTIVKNHDVL
RDIEIPIRPHFGVIAVAPAQDGLIDSIPPSSFAGNLDNWRVTRGASVYLKVAVPGALLSI
GDPHASQGDSELCGTAIECSLTGDFQLILHKSTLIERGAPFADLSYPLVETADEWILHGF
SSPNHLTELGQMAQSHIYLKSTLDDAMRDAFRKTRRFLMTVKGLSEDEAVTLISVAVDFG
ITQVVNGNWGVHAIIRKALFTRS
Download sequence
Identical sequences B2AIB0
164546.RALTA_B0312 gi|188592148|ref|YP_001796746.1| WP_012355163.1.21467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]