SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188592151|ref|YP_001796749.1| from Cupriavidus taiwanensis LMG 19424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188592151|ref|YP_001796749.1|
Domain Number 1 Region: 5-132,163-336
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.57e-88
Family Acetamidase/Formamidase-like 0.0000399
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188592151|ref|YP_001796749.1|
Sequence length 341
Comment hypothetical protein RALTA_B0315 [Cupriavidus taiwanensis LMG 19424]
Sequence
MLHDLPARPETIHWGYFDATQAPALTVKSGDLIRAEAVTHHAGDAPDLMMDDAIREIYRK
VPHDDRHPGVHIMTGPIYVEDAKPGDVLEVRYLQMIPRFRFGANVAASWGQLYKEFEKER
VTIYELDQPSNTAHALYAYDYPGKLTIPGKVVDERECCRQPALAGVRVPVRPHLGTAGVA
PDARGRVTTVEPGLHGGNIDNWRIGAGATMYYPVQVDGALFSIGDPHISQGDGEISGTAI
EASLNVLFQIVLRKDFHFPSPLLETPDCWVVHGFHEDLDEAGRNAARDMIHLLTEQQGLS
RDDAYSLMSVSADFGVTQVVDGTQGIHCTMPRTIFPPKARG
Download sequence
Identical sequences B2AIB3
gi|188592151|ref|YP_001796749.1| WP_012355166.1.21467 WP_012355166.1.63293 164546.RALTA_B0315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]