SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194290560|ref|YP_002006467.1| from Cupriavidus taiwanensis LMG 19424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194290560|ref|YP_002006467.1|
Domain Number 1 Region: 120-287
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.98e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00054
Further Details:      
 
Domain Number 2 Region: 410-553
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.36e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00051
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.09e-33
Family Duplicated SiR/NiR-like domains 1 and 3 0.012
Further Details:      
 
Domain Number 4 Region: 252-276,315-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.78e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194290560|ref|YP_002006467.1|
Sequence length 560
Comment sulfite reductase subunit beta (hemoprotein) [Cupriavidus taiwanensis LMG 19424]
Sequence
MYQYDQYDQRIVAERVAQFRDQVRRRLSGELTEEEFLPLRLQNGLYMQRHAYMLRVAIPY
GLLSSKQMRKLAHIAREYDRGYGHFSTRQNIQYNWMELERVPDVLAELASVEMHAIQTSG
NCVRNITTDHFAGVAPDESVDPRVLAELLRQWSTFQPEFAFLPRKFKIAISASADDRAVV
QMHDIGVYAYKNADGEVRLRILAGGGLGRTPILGTVIKDDLPWQHMLTYIESAIRVYNRY
GRRDNKYKARIKILVKAIGADKFAQEVEEEWQHSKDGPATLTQAEFDRVAQYFTPPAYEK
LADTDASYEKHLLEDKAFARWVSRSVHGHKVPGYAAVTLSTKPGLVSPPGDATDAQMETV
ADLADQFGFGELRVAHEQNLVLPDVKKQDLYALWQLAKKAGLATPNIGLLTDIIACPGGD
FCSLANAKSIPIAQAIQDRFDDLDYVHDLGEISLNISGCINACGHHHVGNIGVLGVDKDG
SEWYQVTLGGAQGNQTALGKVIGPSFSAEEMPDVVSRIIDTFVANRIEDERFIETLSRIG
IAPFKERVYADKQPRERAEA
Download sequence
Identical sequences B3R651
WP_012353706.1.21467 WP_012353706.1.63293 164546.RALTA_A2473 gi|194290560|ref|YP_002006467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]