SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194290890|ref|YP_002006797.1| from Cupriavidus taiwanensis LMG 19424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194290890|ref|YP_002006797.1|
Domain Number 1 Region: 89-296
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.07e-36
Family Phosphate binding protein-like 0.014
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.02e-20
Family LysR-like transcriptional regulators 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194290890|ref|YP_002006797.1|
Sequence length 304
Comment LysR family transcriptional regulator [Cupriavidus taiwanensis LMG 19424]
Sequence
MDLNLIQAFVDIVDAGNLAEAGRRRGVTRSQVSRQLRELEHQAGAQLLRRTTRRLELTEP
GHALYQHGVRILQEVASAQAEIDSLGRTLRGHVRVSVPTGLGDAYIAPLLLQFAQKHPGI
TLRVFFANRVNDLIAAEIDVALKVTSAPPLDHVAREICDIRWQLYAAPQYLARIAPVQVP
PDLEGCSFLCPPFPPRQFPLSLYRDGQRVDVALTPTLQSEHFLFLARAVREGHGIGMLPV
YIGWEEVRAGHLVPVLPDWRPEGLGNKLFIITTPNLHPSMATRALIGFLREELGKLEVFR
DAVK
Download sequence
Identical sequences B3R736
164546.RALTA_A2809 gi|194290890|ref|YP_002006797.1| WP_012354029.1.21467 WP_012354029.1.63293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]