SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194290980|ref|YP_002006887.1| from Cupriavidus taiwanensis LMG 19424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194290980|ref|YP_002006887.1|
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.5e-31
Family Frataxin-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|194290980|ref|YP_002006887.1|
Sequence length 111
Comment frataxin-like protein [Cupriavidus taiwanensis LMG 19424]
Sequence
MPPLSESEFLALATRELDRIEAAVEAAADAADADIEISRTGNVMELEFENGSKIIINSQA
PMQELWVAARAGGFHFRRDGERWIDTRNGGELYAALSGYVSEQAGASLSFH
Download sequence
Identical sequences B3R7C6
WP_012354117.1.21467 164546.RALTA_A2901 gi|194290980|ref|YP_002006887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]