SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194292164|ref|YP_002008071.1| from Cupriavidus taiwanensis LMG 19424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194292164|ref|YP_002008071.1|
Domain Number 1 Region: 90-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.15e-35
Family Phosphate binding protein-like 0.002
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.35e-25
Family LysR-like transcriptional regulators 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194292164|ref|YP_002008071.1|
Sequence length 307
Comment transcriptional regulator of methionine biosynthesis (LysR family) [Cupriavidus taiwanensis LMG 19424]
Sequence
MIEVRHLRSLVAIAESGKLATAAERVHVSQSALSHQIKAIESHYGVPLFDRTRQGLRFTP
AGERLLALAREVLAAISAADRDIERLKGDTRGELRVVLECHTCFDWLMPVMDEFRRRWPE
VEVDLVAGFHADPIALLRNGRADMVIGSQPAARRGLEVAPLFRFEILAVIANEHRLRNKR
RIEAADLAGETLITYPVPESRIDLIREVLEPAGIHLERRTAELTVAVLQLVASRRGVAAL
PNWGVKNYVDHDYVLAKRIGARGLWSELYATVPAAMARRPYVADFVAIVRDTCAAQLDGI
ELLAPAA
Download sequence
Identical sequences B3RAU0
164546.RALTA_B1419 gi|194292164|ref|YP_002008071.1| WP_012356233.1.21467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]