SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194246585|ref|YP_002004224.1| from Candidatus Phytoplasma mali

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194246585|ref|YP_002004224.1|
Domain Number 1 Region: 298-819
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.28e-145
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000000585
Further Details:      
 
Domain Number 2 Region: 147-297
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 2.75e-41
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000894
Further Details:      
 
Domain Number 3 Region: 47-130
Classification Level Classification E-value
Superfamily Flavoproteins 0.000000000323
Family Flavoprotein NrdI 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|194246585|ref|YP_002004224.1|
Sequence length 830
Comment ribonucleotide reductase subunit alpha [Candidatus Phytoplasma mali]
Sequence
MIKIVYDGLKHGQVYNMAKNLNYSFYHVKEYLSNLELKEHLISGLPIFLITKSVNFGEIP
KETKIFLDKHSASTIGVAVSGNKNWGSNFGKAGDLIASNFSIPLVLKFEGSGFDEDVLYL
KKWLSDYIYKNGQKNVIPKWIMLNNQVIDENGNIKDLTKDQEALEIYFKEEIKPKLKYFY
SLKAKIDYLLENNYYEKDFFNHYTYEQIKTIYQIAYAEKFQFASFMGIFKFYNDYALKNR
NKTKYLETYEDRLVVNALYHAHGNFILAKKLIKSLIQQNFTPATPTLLNSGKKYRGEFVS
CFLIEGGDSLNDIARIFEFSMQLSKIGGGVSINLSNLRAKGETIKKNANVCKGVVGVCKL
LDHGFRYADQMGQRNGAGAVYLNVFHADIKDFLNTKKLNADEDVRVKTLSLGVVIPDKML
ELAKNNEMMYIFYPHTVFLEYGQNFADISINMDYWYDILVKNSKIKKKIINPRNLLDLIA
QLQGESGYPYIMYCDNVNKNNMLNLPIKFSNLCTEILQPTITSHYADYDKREEDRIGMDI
SCNLSSGHMGNMIKNNSIKETVFMAMEVMNSVALNTDIAYVPGVAKANRLNRSVGFGIMG
HHEFIAKNFIFFGSEEDLDLIDVFFNAVNYYSLLHSMQKAKTTGQKFFNFSKSKYADGSY
FNNRGEILPKNIKVKNIFKHIKLPSNKDWTELKTNVIKYGLYNSHRLAVAPNGSIGYIMS
TTPSLTPIKQLIEERTYGNSKTYFPTPGLEQFSFMYETAYKINKYRLIDVIATAQKHIDQ
GISFELGITSDITTRELQKYYLYAHYQGIKTLYYTRTQKLKVNECEACGV
Download sequence
Identical sequences B3R0L0
WP_012504339.1.43358 37692.ATP_00187 gi|194246585|ref|YP_002004224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]