SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194246671|ref|YP_002004310.1| from Candidatus Phytoplasma mali

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194246671|ref|YP_002004310.1|
Domain Number 1 Region: 5-203
Classification Level Classification E-value
Superfamily DhaL-like 8.5e-40
Family DhaL-like 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|194246671|ref|YP_002004310.1|
Domain Number - Region: 320-426
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 0.0785
Family ATP synthase (F1-ATPase), gamma subunit 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194246671|ref|YP_002004310.1|
Sequence length 494
Comment kinase [Candidatus Phytoplasma mali]
Sequence
MINAKKINADLFKKMITNGAINLKNNYKKIDNLNVFPVPDGDTGNNMKMTMMEGIKEINK
IQSDSIIKIAEVLSKALLIGAKGNSGVILSQFFAGIYIKLKEINKNTINISEFMKTLICG
YQKAYQAVSEPTEGTILTVIRESVESMKEIEYKDQDINELMQKIIKNSEISLEKTPQLLP
ILKKAKVVDSGGAGFIEILKGMLMFLQGNKLEYNNKEEENNNFEAIHNLDIEELKYIYCS
EYIINLKNDNQIDKEKIKKKLHNKGNSVVLIIDENILKLHIHTNNPDIVLNYLLNYGELN
KIKIDNMKQQHEKIIKTKKNNQLKEKKNSKYTIITVVSGNKMLQSFQELNADIIIDETIN
MSLKVNDFIEKIKEIDNRNIIILPNRTKIYLEVQKIINILPEKNIKIIKTESFAQGYSVL
LTFDPNLDLEKNLNNMKQKLKNTKIGKIINEKDTDLTLNNNENNNDFICFLEEKKIYKNN
DLNRARKMPKLLAN
Download sequence
Identical sequences B3QZS7
WP_012504425.1.43358 gi|194246671|ref|YP_002004310.1| 37692.ATP_00277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]