SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194246675|ref|YP_002004314.1| from Candidatus Phytoplasma mali

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194246675|ref|YP_002004314.1|
Domain Number 1 Region: 160-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-48
Family G proteins 0.000013
Further Details:      
 
Domain Number 2 Region: 2-157
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 7.32e-46
Family Obg GTP-binding protein N-terminal domain 0.0000081
Further Details:      
 
Domain Number 3 Region: 348-420
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 0.00000000000000301
Family Obg GTP-binding protein C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194246675|ref|YP_002004314.1|
Sequence length 421
Comment GTPase ObgE [Candidatus Phytoplasma mali]
Sequence
MYFIDEAINEIKAGNGGNGVVSFRKEKYVPLGGPDGGNGGKGGSIFFIGEQSENNLLKLK
YQKHLKAKNGENGKNKNKHGANAENIYIKVPLGTIIYNLQNEITGEILKHGEILTIAKGG
RGGKGNKSLATFKNPVPKYAEKGGIGESFKIKTELKILADVGLIGYPSVGKSTLISIISD
AKPKIADYPFTTLKPYLGMVYVDNESFIVADLPGLIPNAHLGKGMGIKFLKHIERCRILI
HMCDMSKSNPLQDIENLNQELKIYNKNLLKKPQIIIANKMDIIGAKTKLIELQKKILNKN
IIPTSLLKNQNLKILKYKMLEMIKKNVVNLPLCENSSFKTYTLEEEKPDFVIKKDNQGFF
VVKGEKIEKFFYKTDFNNEEATKKFAIFLKKIGVEEELIKKGVYFSKNKIKICDRVFEFI
T
Download sequence
Identical sequences B3QZT1
WP_012504429.1.43358 gi|194246675|ref|YP_002004314.1| 37692.ATP_00281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]