SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194246773|ref|YP_002004412.1| from Candidatus Phytoplasma mali

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194246773|ref|YP_002004412.1|
Domain Number 1 Region: 324-491
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.38e-44
Family Ribonuclease PH domain 1-like 0.0000252
Further Details:      
 
Domain Number 2 Region: 17-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-39
Family Ribonuclease PH domain 1-like 0.0000463
Further Details:      
 
Domain Number 3 Region: 476-584
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.46e-23
Family Ribonuclease PH domain 2-like 0.00019
Further Details:      
 
Domain Number 4 Region: 143-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-20
Family Ribonuclease PH domain 2-like 0.0038
Further Details:      
 
Domain Number 5 Region: 637-726
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000133
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 6 Region: 583-660
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000326
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 
Domain Number 7 Region: 232-348
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000549
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|194246773|ref|YP_002004412.1|
Sequence length 728
Comment polynucleotide phosphorylase/polyadenylase [Candidatus Phytoplasma mali]
Sequence
MDLNTKNNNKKVFEIIFENNVLRIEIGEISRQANGSVMLFYKDTVILSVAVCGDKKNSLN
FLPLTVNYQEKLYAAGKIPGGFLRREGKPSDQEILCSRLIDRTIRPLFSKNFKNEVQLIN
MVLSSDPDGNNENIALLGSSLALLISDIPFFEPVSSVCVGKIGDNLIINPTLSQRENSSF
FLILAGTKDSLNMVEMSSKEISENNFLESIKFGHEIIKKLCLFQTEIANQIGKTKIKIPL
HNVNNLLEVEIKDKYFSEIEMILKNKCNVNNVKKSDILKKLKENVLENYKEKFLNNKKDN
FNLLDLENQKLYLNEVEIIFDFLVRTIIRETILKENIRPDGRNSSEIRSITSRIDILPRT
HGSALFTRGGTQSLAIVTLGTLRESKIIDDLSDEVDKRFMLHYNFPAFAVGSVGRYLAPS
RREIGHGMLAEKALECVLPSENDFPYSIRVVSEILDSNGSSSQATICASSMALMSAGVPL
KSLVAGVAMGLIVDDIDKINHYTILSDIEGLEDYQGDIDFKIAGTKVGITALQLDIKIKG
ITLEIFEKVLEQAKKDRIKILNEMEKVINKSRNEVSKYAPKVKMILIKPEKIRDIIGSGG
KIINQIIEKHDNVKIDIMQDGKIYIMHQNMEIVDLTVTYIQNFLKKIKVENVYEVKILRF
VKDKMDKTFGAIAEIFPGIEGFIHISKLENYKVDKVEDVLKIGQIILVKCIKINERGQID
LSKKDVFK
Download sequence
Identical sequences B3QZG1
WP_012504527.1.43358 37692.ATP_00381 gi|194246773|ref|YP_002004412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]