SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194246832|ref|YP_002004471.1| from Candidatus Phytoplasma mali

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194246832|ref|YP_002004471.1|
Domain Number 1 Region: 8-117
Classification Level Classification E-value
Superfamily Ribosomal protein L20 5.89e-43
Family Ribosomal protein L20 0.0000453
Further Details:      
 
Domain Number 2 Region: 186-220
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000294
Family Rho termination factor, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194246832|ref|YP_002004471.1|
Sequence length 226
Comment 50S ribosomal protein L20 [Candidatus Phytoplasma mali]
Sequence
MSKISFVPARHRRRKKILKLAKGYVGSKSTIYKTAHEQVMRSLQYAYRDRKQRKREFKKL
WISRINASVFAYGIKYSSFVHGLKLANVFINRKVLSELAIHNPDVFVQYVELAKKFLSEK
ISTTITKPKKVLINEILNEKKINVNQLKNEKKNTKDLNDIDKRTSELKNNNDKTLLLEKE
NDIEHIDLSKMLVKDLKDLAKKHNINNFNKLKKTDLIKVLKSFYKQ
Download sequence
Identical sequences B3R0P6
WP_012504586.1.43358 gi|194246832|ref|YP_002004471.1| 37692.ATP_00443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]